Is TB-500 from Lumera Labs HPLC verified?

Yes. Every TB-500 lot Lumera Labs ships is HPLC-purity tested at synthesis and retested by Janoshik Analytical before release. The lot-specific Certificate of Analysis is published on the Lab Results page.

Is TB-500 sold for human use?

No. TB-500 is sold strictly as a laboratory reference standard for in-vitro research. It is not approved by Health Canada or the FDA for human use. Every order requires a research-use declaration.

How is TB-500 shipped?

TB-500 is lyophilized at synthesis, sealed under nitrogen, and shipped from Kelowna, BC at -20 C through cold-chain insulated packaging via Canada Post Xpresspost. Free shipping over $200 CAD. 24-48h transit Canada-wide.

Where can I see the COA for TB-500?

Each shipment includes a lot-specific Certificate of Analysis. The current lot's COA is also published at https://lumerapeptide.com/lab-results/ and can be cross-referenced by the batch number printed on each vial.

4.9 · 334 researcher reviews

Healing · Thymosin Fragment

TB-500

SKU LUM-TB500-5 · C₂₁₂H₃₅₀N₅₆O₇₈S · 4963.44 g/mol · CAS 77591-33-4

A synthetic 43-residue fragment of Thymosin Beta-4 supplied as a research reference standard. Studied for cellular migration, actin sequestration, and tissue-repair pathways.

Purity (HPLC): ≥ 99.08%
Net peptide: 5.00 mg ± 2%
Endotoxin: < 0.5 EU/mg
Format: Lyophilized vial
Storage: −20 °C, desiccated
Shelf life: 24 months from MFG

$70CAD / 5 mg vial

In stock · Lot 26-A031

Bulk 10+: $24 / vial

Add $200 for free cold-chain shipping

HPLC + MS verified per lot
Cold-chain to your door
COA bundled with shipment
Lot retains kept 5 years

Overview

TB-500 is a synthetic acetylated peptide corresponding to a partial sequence of Thymosin Beta-4 (Tβ4). It binds G-actin and modulates actin-cytoskeleton dynamics, and is investigated in cell-migration, angiogenesis, and tissue-repair models. Frequently paired with BPC-157 in comparative healing-axis protocols.

Each vial is lyophilized from acetate buffer, sealed under nitrogen, and held at −20 °C through ship. Cold-chain insulation is maintained from our Kelowna facility to your bench.

Research applications

In-vitro cell-migration (scratch/wound) assays, fibroblast proliferation studies, HUVEC tube-formation angiogenesis, and comparative musculoskeletal-repair protocols paired with BPC-157.

Sold for laboratory research only. This material is not a drug, food, or cosmetic and is not intended for diagnostic, therapeutic, or recreational use.

Identity

Parameter	Value
Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular formula	C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular weight	4963.44 g/mol
CAS number	77591-33-4
Length	43 residues

Quality

Test	Specification
HPLC purity	≥ 99.0% (lot LM-2622: 99.08%)
Mass confirmation	ESI-MS within 0.5 Da
Net peptide content	≥ 80% by AAA
Endotoxin	< 0.5 EU/mg (LAL)
Bioburden	< 10 CFU/g
Residual TFA	< 1.0%

Lot LM-2622

Manufactured 04 Mar 2026 · Released 11 Mar 2026 · Tested by Lumera QC, Kelowna BC. Retain samples held under storage spec for five years from release date.

Verification

Method	Result
RP-HPLC at 220 nm	99.08% main peak
ESI-MS (positive)	4963.4 Da (theor. 4963.44)
Amino acid analysis	82.1% net peptide
LAL endotoxin	< 0.05 EU/mg
Karl Fischer (water)	2.8% w/w

Reconstitution

Allow vial to reach room temperature before opening (≥ 20 minutes). Reconstitute with 1.0–2.5 mL of sterile bacteriostatic water (0.9% benzyl alcohol). Inject solvent slowly down the inner wall of the vial; do not direct stream onto the lyophilized cake.

Swirl gently for 30 seconds. Do not vortex. Allow to dissolve for 5 minutes; clarity should be complete with no visible particulates.

Storage after reconstitution

Reconstituted solution is stable for 28 days at 2–8 °C in original vial. For longer storage, aliquot into low-binding tubes and hold at −80 °C; avoid repeated freeze-thaw cycles. Discard if turbidity, color change, or particulate matter is observed.

Selected references

Goldstein AL et al. Thymosin β4: actin-sequestering protein moonlights to repair injured tissues. Trends Mol Med. 2005;11(9):421–429.

Sosne G et al. Thymosin beta 4 promotes corneal wound healing and modulates inflammatory mediators in vivo. Exp Eye Res. 2002;74(2):293–299.

Crockford D et al. Thymosin β4: structure, function, and biological properties supporting current and future clinical applications. Ann N Y Acad Sci. 2010;1194:179–189.

Citing this material

TB-500 reference standard, ≥99% (HPLC), Lumera Labs Inc., Cat. No. LUM-TB500-5, Lot 26-A031.

Related · Healing axis

Often paired in studies.

View catalog →

GLP-1/GIP · Metabolic

Tirzepatide

10 mg · ≥ 99.3%

$40 CADView →

Tri-agonist · Metabolic

Retatrutide

10 mg · ≥ 99.2%

$85 CADView →

Metabolic

Cagrisema

10 mg · ≥ 99.1%

$72 CADView →

Growth axis

AOD-9604

5 mg · ≥ 99.0%

$36 CADView →

Why Lumera

Janoshik Analytical HPLC ≥ 99.08% on this lot
LC-MS identity confirmed before release
LAL endotoxin below detection limit
Cold-chain shipped −20°C from Kelowna, BC

Background research

What the literature says about Tb 500.

Mechanism

Tb 500 is Thymosin Beta-4 fragment, classified within the actin-sequestration pathway. Structurally it is a synthetic 43-residue Tβ4 fragment. TB-500 is a synthetic acetylated peptide corresponding to a partial sequence of Thymosin Beta-4 (Tβ4), the principal G-actin-sequestering protein in mammalian cells. Goldstein et al. (2005) characterized its role in actin-cytoskeleton dynamics and its emerging significance in tissue-repair models.

In an in-vitro setting, Tb 500 interacts with its target receptor(s) at low-nanomolar affinities under standard binding-assay conditions. Reconstitution should be performed in sterile bacteriostatic water at the working concentration your protocol specifies; the lyophilized vial is sealed under nitrogen and stable at −20 °C until reconstituted.

Common research applications

In-vitro receptor-binding and dose-response screens against the actin-sequestration target panel.
Comparative pharmacology against related class members and previously published reference standards.
Time-course studies leveraging Tb 500's known stability profile.
Cross-batch HPLC fingerprint comparison against the lot-specific COA we publish for every release.

Storage & handling

Tb 500 arrives lyophilized at −20 °C in cold-chain insulated packaging. On receipt, transfer immediately to a −20 °C freezer. Once reconstituted, store at 2-8 °C and use within the window noted on the lot's COA. Avoid repeated freeze-thaw cycles.

References

Goldstein AL et al. Trends Mol Med. 2005;11(9):421-9.
Sosne G et al. Exp Eye Res. 2002;74(2):293-9.
Crockford D et al. Ann N Y Acad Sci. 2010;1194:179-89.

For laboratory research only. Tb 500 is sold strictly as an in-vitro reference standard. It is not approved for human or veterinary use by Health Canada or the FDA.