Is IGF-1 LR3 from Lumera Labs HPLC verified?

Yes. Every IGF-1 LR3 lot Lumera Labs ships is HPLC-purity tested at synthesis and retested by Janoshik Analytical before release. The lot-specific Certificate of Analysis is published on the Lab Results page.

Is IGF-1 LR3 sold for human use?

No. IGF-1 LR3 is sold strictly as a laboratory reference standard for in-vitro research. It is not approved by Health Canada or the FDA for human use. Every order requires a research-use declaration.

How is IGF-1 LR3 shipped?

IGF-1 LR3 is lyophilized at synthesis, sealed under nitrogen, and shipped from Kelowna, BC at -20 C through cold-chain insulated packaging via Canada Post Xpresspost. Free shipping over $200 CAD. 24-48h transit Canada-wide.

Where can I see the COA for IGF-1 LR3?

Each shipment includes a lot-specific Certificate of Analysis. The current lot's COA is also published at https://lumerapeptide.com/lab-results/ and can be cross-referenced by the batch number printed on each vial.

Home / Catalog / Growth Axis / IGF-1 LR3 1 mg

4.7 · 52 researcher reviews

Growth axis · IGF-1 analog

IGF-1 LR3

SKU LUM-IGFLR3-1 · C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ · 9117.55 g/mol · CAS 946870-92-4

A modified IGF-1 analog with a 13-residue N-terminal extension and Arg³ substitution that reduces IGFBP binding and extends functional half-life.

Purity (HPLC): ≥ 99.3%
Net peptide: 5.00 mg ± 2%
Endotoxin: < 0.5 EU/mg
Format: Lyophilized vial
Storage: −20 °C, desiccated
Shelf life: 24 months from MFG

$120CAD / 1 mg vial

In stock · Lot 26-A031

Bulk 10+: $24 / vial

Add $200 for free cold-chain shipping

HPLC + MS verified per lot
Cold-chain to your door
COA bundled with shipment
Lot retains kept 5 years

Overview

IGF-1 LR3 is a synthetic 83-residue analog of insulin-like growth factor 1, modified with a 13-residue N-terminal extension and an arginine substitution at position 3. The combined modifications dramatically reduce binding to IGF-binding proteins (IGFBPs) and extend the functional half-life relative to native IGF-1.

Each vial is lyophilized from acetate buffer, sealed under nitrogen, and shipped cold-chain at −20 °C from our Kelowna facility.

Research applications

IGF-1 receptor activation assays, comparative IGFBP-binding studies versus native IGF-1, in-vitro myoblast/fibroblast proliferation models, and PI3K/AKT signaling investigations.

Sold for laboratory research only. This material is not a drug, food, or cosmetic and is not intended for diagnostic, therapeutic, or recreational use.

Identity

Parameter	Value
Sequence	Long Arg³ analog of IGF-1 (extended N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPT + Arg³ substitution)
Molecular formula	C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular weight	9117.55 g/mol
CAS number	946870-92-4
Length	83 residues

Quality

Test	Specification
HPLC purity	≥ 99.0% (lot LM-2649: 99.05%)
Mass confirmation	ESI-MS within 0.5 Da
Net peptide content	≥ 80% by AAA
Endotoxin	< 0.5 EU/mg (LAL)
Bioburden	< 10 CFU/g
Residual TFA	< 1.0%

Lot LM-2649

Manufactured 04 Mar 2026 · Released 11 Mar 2026 · Tested by Lumera QC, Kelowna BC. Retain samples held under storage spec for five years from release date.

Verification

Method	Result
RP-HPLC at 220 nm	99.05% main peak
ESI-MS (positive)	9117.6 Da (theor. 9117.55)
Amino acid analysis	82.1% net peptide
LAL endotoxin	< 0.05 EU/mg
Karl Fischer (water)	2.8% w/w

Reconstitution

Allow vial to reach room temperature before opening (≥ 20 minutes). Reconstitute with 1.0–2.5 mL of sterile bacteriostatic water (0.9% benzyl alcohol). Inject solvent slowly down the inner wall of the vial; do not direct stream onto the lyophilized cake.

Swirl gently for 30 seconds. Do not vortex. Allow to dissolve for 5 minutes; clarity should be complete with no visible particulates.

Storage after reconstitution

Reconstituted solution is stable for 28 days at 2–8 °C in original vial. For longer storage, aliquot into low-binding tubes and hold at −80 °C; avoid repeated freeze-thaw cycles. Discard if turbidity, color change, or particulate matter is observed.